Lineage for d4ffvc1 (4ffv C:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760239Domain d4ffvc1: 4ffv C:1-106 [221186]
    Other proteins in same PDB: d4ffva1, d4ffva2, d4ffvb1, d4ffvb2, d4ffvc2, d4ffvd_, d4ffvh_, d4ffvl2
    automated match to d1sy6l1

Details for d4ffvc1

PDB Entry: 4ffv (more details), 2.4 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with 11a19 fab
PDB Compounds: (C:) 11A19 Fab light chain

SCOPe Domain Sequences for d4ffvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffvc1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivlsqspailsaspgekvtmtcrasssvnnmhwyqqkpgsspkpwlhgtsnlasgvpvr
fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkleid

SCOPe Domain Coordinates for d4ffvc1:

Click to download the PDB-style file with coordinates for d4ffvc1.
(The format of our PDB-style files is described here.)

Timeline for d4ffvc1: