SCOPe 2.06: Domain d4ffva2: 4ffv A:510-765

Lineage for d4ffva2 (4ffv A:510-765)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (8 PDB entries)

8. Domain d4ffva2: 4ffv A:510-765 [221183]
   Other proteins in same PDB: d4ffva1, d4ffvb1, d4ffvc1, d4ffvc2, d4ffvl1, d4ffvl2
   automated match to d1orva2

Details for d4ffva2

PDB Entry: 4ffv, 2.4 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with 11a19 fab

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4ffva2:

Sequence; same for both SEQRES and ATOM records:

>d4ffva2 c.69.1.0 (A:510-765) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfs

Timeline for d4ffva2:

• d4ffva2 first appeared in SCOPe 2.03
  
• d4ffva2 appears in SCOPe 2.05
  
• d4ffva2 appears in SCOPe 2.07
  
• d4ffva2 appears in the current release, SCOPe 2.08