SCOPe 2.04: Domain d1f49c2: 1f49 C:626-730

Lineage for d1f49c2 (1f49 C:626-730)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
   Uniprot P00722

8. Domain d1f49c2: 1f49 C:626-730 [22118]
   Other proteins in same PDB: d1f49a3, d1f49a4, d1f49a5, d1f49b3, d1f49b4, d1f49b5, d1f49c3, d1f49c4, d1f49c5, d1f49d3, d1f49d4, d1f49d5, d1f49e3, d1f49e4, d1f49e5, d1f49f3, d1f49f4, d1f49f5, d1f49g3, d1f49g4, d1f49g5, d1f49h3, d1f49h4, d1f49h5
   complexed with mg

Details for d1f49c2

PDB Entry: 1f49, 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1f49c2:

Sequence; same for both SEQRES and ATOM records:

>d1f49c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1f49c2:

• d1f49c2 first appeared (with stable ids) in SCOP 1.55
  
• d1f49c2 appears in SCOPe 2.03
  
• d1f49c2 appears in SCOPe 2.05
  
• d1f49c2 appears in the current release, SCOPe 2.07