Lineage for d4ffuh1 (4ffu H:1-148)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551631Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry)
  8. 2551639Domain d4ffuh1: 4ffu H:1-148 [221177]
    Other proteins in same PDB: d4ffua2, d4ffub2, d4ffuh2, d4ffui2
    automated match to d1q6wc_
    complexed with cl

Details for d4ffuh1

PDB Entry: 4ffu (more details), 1.8 Å

PDB Description: crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021
PDB Compounds: (H:) oxidase

SCOPe Domain Sequences for d4ffuh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffuh1 d.38.1.0 (H:1-148) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mseqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktlpggqriah
gtmifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakeddpkrpgagr
vvercevinqrgevvlaadhiliverkp

SCOPe Domain Coordinates for d4ffuh1:

Click to download the PDB-style file with coordinates for d4ffuh1.
(The format of our PDB-style files is described here.)

Timeline for d4ffuh1: