| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
| Protein automated matches [190143] (19 species) not a true protein |
| Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry) |
| Domain d4ffuh_: 4ffu H: [221177] automated match to d1q6wc_ complexed with cl |
PDB Entry: 4ffu (more details), 1.8 Å
SCOPe Domain Sequences for d4ffuh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffuh_ d.38.1.0 (H:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
enlyfqsmmseqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktl
pggqriahgtmifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakedd
pkrpgagrvvercevinqrgevvlaadhiliverkp
Timeline for d4ffuh_: