Lineage for d4ffuh_ (4ffu H:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410619Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1410620Protein automated matches [190143] (19 species)
    not a true protein
  7. 1410700Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry)
  8. 1410708Domain d4ffuh_: 4ffu H: [221177]
    automated match to d1q6wc_
    complexed with cl

Details for d4ffuh_

PDB Entry: 4ffu (more details), 1.8 Å

PDB Description: crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021
PDB Compounds: (H:) oxidase

SCOPe Domain Sequences for d4ffuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffuh_ d.38.1.0 (H:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
enlyfqsmmseqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktl
pggqriahgtmifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakedd
pkrpgagrvvercevinqrgevvlaadhiliverkp

SCOPe Domain Coordinates for d4ffuh_:

Click to download the PDB-style file with coordinates for d4ffuh_.
(The format of our PDB-style files is described here.)

Timeline for d4ffuh_: