Lineage for d4ffuf_ (4ffu F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902644Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry)
  8. 1902650Domain d4ffuf_: 4ffu F: [221175]
    automated match to d1q6wc_
    complexed with cl

Details for d4ffuf_

PDB Entry: 4ffu (more details), 1.8 Å

PDB Description: crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021
PDB Compounds: (F:) oxidase

SCOPe Domain Sequences for d4ffuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffuf_ d.38.1.0 (F:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
eqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktlpggqriahgt
mifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakeddpkrpgagrvv
ercevinqrgevvlaadhiliverk

SCOPe Domain Coordinates for d4ffuf_:

Click to download the PDB-style file with coordinates for d4ffuf_.
(The format of our PDB-style files is described here.)

Timeline for d4ffuf_: