Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (32 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry) |
Domain d4ffuf_: 4ffu F: [221175] automated match to d1q6wc_ complexed with cl |
PDB Entry: 4ffu (more details), 1.8 Å
SCOPe Domain Sequences for d4ffuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffuf_ d.38.1.0 (F:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} eqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktlpggqriahgt mifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakeddpkrpgagrvv ercevinqrgevvlaadhiliverk
Timeline for d4ffuf_: