Lineage for d4ffja_ (4ffj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971984Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2971985Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2972056Family d.115.1.0: automated matches [191657] (1 protein)
    not a true family
  6. 2972057Protein automated matches [191228] (2 species)
    not a true protein
  7. 2972063Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [226724] (1 PDB entry)
  8. 2972064Domain d4ffja_: 4ffj A: [221169]
    automated match to d1g57b_
    complexed with gol, so4

Details for d4ffja_

PDB Entry: 4ffj (more details), 1.95 Å

PDB Description: The crystal structure of spDHBPs from S.pneumoniae
PDB Compounds: (A:) Riboflavin biosynthesis protein ribBA

SCOPe Domain Sequences for d4ffja_:

Sequence, based on SEQRES records: (download)

>d4ffja_ d.115.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
meyrkiqealealqkgrlvlviddkdrenegdlicsaqaattenvnfmatyakglicmpm
seslanqlmlspmvenntdnhktaftvsidyketttgisaeergltarmcvaeditpsdf
rrpghmfpliakkggvlernghteatvdllklaglkecglcceimnhdgkmmrtddliqf
skkhniplitikelqeyrkvydql

Sequence, based on observed residues (ATOM records): (download)

>d4ffja_ d.115.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
meyrkiqealealqkgrlvlviddkdnegdlicsaqaattenvnfmatyakglicmpmse
slanqlmlspmvetaftvsidyketttgisaeergltarmcvaeditpsdfrrpghmfpl
iakkggvlernghteatvdllklaglkecglcceimnhdgkmmrtddliqfskkhnipli
tikelqeyrkvydql

SCOPe Domain Coordinates for d4ffja_:

Click to download the PDB-style file with coordinates for d4ffja_.
(The format of our PDB-style files is described here.)

Timeline for d4ffja_: