Lineage for d4ffcc_ (4ffc C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897473Species Mycobacterium abscessus [TaxId:561007] [226405] (1 PDB entry)
  8. 2897476Domain d4ffcc_: 4ffc C: [221167]
    automated match to d1ohwa_
    complexed with edo

Details for d4ffcc_

PDB Entry: 4ffc (more details), 1.8 Å

PDB Description: crystal structure of a 4-aminobutyrate aminotransferase (gabt) from mycobacterium abscessus
PDB Compounds: (C:) 4-aminobutyrate aminotransferase (GabT)

SCOPe Domain Sequences for d4ffcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffcc_ c.67.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
ityrlaqkrtivtplpgprsgalaerrraavsagvgstapvyavdadggvivdadgnsfi
dlgagiavttvgashpavaaaiadqathfthtcfmvtpyeqyvqvaellnaltpgdhdkr
talfnsgaeavenaikvarlatgrpavvafdnayhgrtnltmaltaksmpyksqfgpfap
evyrmpasyplrdepgltgeeaarraisrietqigaqslaaiiiepiqgeggfivpapgf
latltawasengvvfiadevqtgfartgawfasehegivpdivtmakgiaggmplsavtg
raelmdavyagglggtyggnpvtcaaavaalgvmreldlpararaieasvtsrlsalaee
vdiigevrgrgamlaieivkpgtlepdaaltksiaaealsqgvliltcgtfgnvirllpp
lvigddlldegitalsdiirakas

SCOPe Domain Coordinates for d4ffcc_:

Click to download the PDB-style file with coordinates for d4ffcc_.
(The format of our PDB-style files is described here.)

Timeline for d4ffcc_: