Lineage for d4ffca_ (4ffc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148988Species Mycobacterium abscessus [TaxId:561007] [226405] (1 PDB entry)
  8. 2148989Domain d4ffca_: 4ffc A: [221165]
    automated match to d1ohwa_
    complexed with edo

Details for d4ffca_

PDB Entry: 4ffc (more details), 1.8 Å

PDB Description: crystal structure of a 4-aminobutyrate aminotransferase (gabt) from mycobacterium abscessus
PDB Compounds: (A:) 4-aminobutyrate aminotransferase (GabT)

SCOPe Domain Sequences for d4ffca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffca_ c.67.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
dityrlaqkrtivtplpgprsgalaerrraavsagvgstapvyavdadggvivdadgnsf
idlgagiavttvgashpavaaaiadqathfthtcfmvtpyeqyvqvaellnaltpgdhdk
rtalfnsgaeavenaikvarlatgrpavvafdnayhgrtnltmaltaksmpyksqfgpfa
pevyrmpasyplrdepgltgeeaarraisrietqigaqslaaiiiepiqgeggfivpapg
flatltawasengvvfiadevqtgfartgawfasehegivpdivtmakgiaggmplsavt
graelmdavyagglggtyggnpvtcaaavaalgvmreldlpararaieasvtsrlsalae
evdiigevrgrgamlaieivkpgtlepdaaltksiaaealsqgvliltcgtfgnvirllp
plvigddlldegitalsdiiraka

SCOPe Domain Coordinates for d4ffca_:

Click to download the PDB-style file with coordinates for d4ffca_.
(The format of our PDB-style files is described here.)

Timeline for d4ffca_: