SCOPe 2.03: Domain d4ffbb1: 4ffb B:1-243

Lineage for d4ffbb1 (4ffb B:1-243)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.0: automated matches [227136] (1 protein)
   not a true family

6. Protein automated matches [226838] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224885] (1 PDB entry)

8. Domain d4ffbb1: 4ffb B:1-243 [221163]
   Other proteins in same PDB: d4ffba2, d4ffbb2
   automated match to d1tubb1
   complexed with gtp, mg

Details for d4ffbb1

PDB Entry: 4ffb, 2.88 Å

PDB Description: A TOG:alpha/beta-tubulin Complex Structure Reveals Conformation-Based Mechanisms For a Microtubule Polymerase

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4ffbb1:

Sequence, based on SEQRES records:

>d4ffbb1 c.32.1.0 (B:1-243) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mreiihistgqcgnqigaafweticgehgldfngtyhghddiqkerlnvyfneassgkwv
prsinvdlepgtidavrnsaignlfrpdnyifgqssagnvwakghytegaelvdsvmdvi
rreaegcdslqgfqithslgggtgsgmgtlliskireefpdrmmatfsvlpspkrsdtrv
epynatlsvhqlvehsdetfcidnealydicqrtlklnqpsygdlnnlvssvmsgvttsl
ryp

Sequence, based on observed residues (ATOM records):

>d4ffbb1 c.32.1.0 (B:1-243) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mreiihistgqcgnqigaafweticgehgldfngthddiqkerlnvyfneassgkwvprs
invdlepgtidavrnsaignlfrpdnyifgqssagnvwakghytegaelvdsvmdvirre
aegcdslqgfqithslgggtgsgmgtlliskireefpdrmmatfsvlpspktrvepynat
lsvhqlvehsdetfcidnealydicqrtlklnqpsygdlnnlvssvmsgvttslryp

Timeline for d4ffbb1:

• d4ffbb1 is new in SCOPe 2.03-stable
  
• d4ffbb1 appears in SCOPe 2.04
  
• d4ffbb1 appears in the current release, SCOPe 2.08