Lineage for d4ffba2 (4ffb A:247-439)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657962Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 1657963Protein automated matches [226843] (5 species)
    not a true protein
  7. 1657967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224936] (2 PDB entries)
  8. 1657968Domain d4ffba2: 4ffb A:247-439 [221162]
    Other proteins in same PDB: d4ffba1, d4ffbb1
    automated match to d1jffa2
    complexed with gtp, mg

Details for d4ffba2

PDB Entry: 4ffb (more details), 2.88 Å

PDB Description: A TOG:alpha/beta-tubulin Complex Structure Reveals Conformation-Based Mechanisms For a Microtubule Polymerase
PDB Compounds: (A:) Tubulin alpha-1 chain

SCOPe Domain Sequences for d4ffba2:

Sequence, based on SEQRES records: (download)

>d4ffba2 d.79.2.0 (A:247-439) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gslnvdlnefqtnlvpyprihfplvsyspvlskskafhesnsvseitnacfepgnqmvkc
dprdgkymatcllyrgdvvtrdvqraveqvknkktvqlvdwcptgfkigicyepptatpn
sqlatvdravcmlsnttsiaeawkridrkfdlmyakrafvhwyvgegmeegeftearedl
aalerdyievgad

Sequence, based on observed residues (ATOM records): (download)

>d4ffba2 d.79.2.0 (A:247-439) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gslnvdlnefqtnlvpyprihfplvsyspvlsksesnsvseitnacfepgnqmvkcdprd
gkymatcllyrgdvvtrdvqraveqvknkktvqlvdwcptgfkigicyepptatpnsqla
tvdravcmlsnttsiaeawkridrkfdlmyakrafvhwyvgegmeegeftearedlaale
rdyievgad

SCOPe Domain Coordinates for d4ffba2:

Click to download the PDB-style file with coordinates for d4ffba2.
(The format of our PDB-style files is described here.)

Timeline for d4ffba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ffba1