![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.0: automated matches [227136] (1 protein) not a true family |
![]() | Protein automated matches [226838] (4 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224885] (2 PDB entries) |
![]() | Domain d4ffba1: 4ffb A:1-246 [221161] Other proteins in same PDB: d4ffba2, d4ffbb2 automated match to d1jffa1 complexed with gtp, mg |
PDB Entry: 4ffb (more details), 2.88 Å
SCOPe Domain Sequences for d4ffba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffba1 c.32.1.0 (A:1-246) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mrevisinvgqagcqignacwelyslehgikpdghledglskpkggeegfstffhetgyg kfvpraiyvdlepnvidevrngpykdlfhpeqlisgkedaannyarghytvgreilgdvl drirkladqcdglqgflfthslgggtgsglgsllleelsaeygkksklefavypapqvst svvepyntvltthttlehadctfmvdneaiydmckrnldiprpsfanlnnliaqvvssvt aslrfd
Timeline for d4ffba1: