Lineage for d4feza1 (4fez A:3-89,A:208-467)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080826Species Vibrio cholerae [TaxId:243277] [226404] (1 PDB entry)
  8. 2080827Domain d4feza1: 4fez A:3-89,A:208-467 [221159]
    automated match to d2cu0a1
    complexed with edo, fmt, peg; mutant

Details for d4feza1

PDB Entry: 4fez (more details), 2.16 Å

PDB Description: inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4feza1:

Sequence, based on SEQRES records: (download)

>d4feza1 c.1.5.0 (A:3-89,A:208-467) automated matches {Vibrio cholerae [TaxId: 243277]}
mlriakealtfddvllvpahstvlpntadlrtrltknialnipmvsasmdtvtearlaia
laqeggigfihknmsieqqaaqvhqvkXskpnackdeqgrlrvgaavgaapgneervkal
veagvdvllidsshghsegvlqriretraayphleiiggnvataegaralieagvsavkv
gigpgsicttrivtgvgvpqitaiadaagvaneygipviadggirfsgdiskaiaagasc
vmvgsmfagteeapgevilyqgrsykayrgmgslgamskgssdryfqtdnaadklvpegi
egriaykghlkeiihqqmgglrscmgltgsatvedlrtkaqfvrisga

Sequence, based on observed residues (ATOM records): (download)

>d4feza1 c.1.5.0 (A:3-89,A:208-467) automated matches {Vibrio cholerae [TaxId: 243277]}
mlriakealtfddvllvpahstvlpntadlrtrltknialnipmvsasmdtvtearlaia
laqeggigfihknmsieqqaaqvhqvkXskpnackdeqgrlrvgaavgaapgneervkal
veagvdvllidsshghsegvlqriretraayphleiiggnvataegaralieagvsavkv
gigpgsicttrivtgvgvpqitaiadaagvaneygipviadggirfsgdiskaiaagasc
vmvgsmfagteeapgevilyqgrsykayriaykghlkeiihqqmgglrscmgltgsatve
dlrtkaqfvrisga

SCOPe Domain Coordinates for d4feza1:

Click to download the PDB-style file with coordinates for d4feza1.
(The format of our PDB-style files is described here.)

Timeline for d4feza1: