Lineage for d4feqa_ (4feq A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1674829Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1674830Protein automated matches [190417] (19 species)
    not a true protein
  7. 1675641Species Mouse (Mus musculus) [TaxId:10090] [194605] (16 PDB entries)
  8. 1675652Domain d4feqa_: 4feq A: [221158]
    automated match to d1p4ob_
    complexed with 0t8

Details for d4feqa_

PDB Entry: 4feq (more details), 2.2 Å

PDB Description: Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky)
PDB Compounds: (A:) Tyrosine-protein kinase receptor TYRO3

SCOPe Domain Sequences for d4feqa_:

Sequence, based on SEQRES records: (download)

>d4feqa_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eqqftlgrmlgkgefgsvreaqlkqedgsfvkvavkmlkadiiassdieeflreaacmke
fdhphvaklvgvslrsrakgrlpipmvilpfmkhgdlhafllasrigenpfnlplqtlvr
fmvdiacgmeylssrnfihrdlaarncmlaedmtvcvadfglsrkiysgdyyrqgcaskl
pvkwlalesladnlytvhsdvwafgvtmweimtrgqtpyagienaeiynyliggnrlkqp
pecmeevydlmyqcwsadpkqrpsftclrmelenilghl

Sequence, based on observed residues (ATOM records): (download)

>d4feqa_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eqqftlgrmlgkgsvreaqlkdgsfvkvavkmlflreaacmkefdhphvaklvgvspmvi
lpfmkhgdlhafllasriplqtlvrfmvdiacgmeylssrnfihrdlaarncmlaedmtv
cvadfgvkwlalesladnlytvhsdvwafgvtmweimtrgqtpyagienaeiynyliggn
rlkqppecmeevydlmyqcwsadpkqrpsftclrmelenilghl

SCOPe Domain Coordinates for d4feqa_:

Click to download the PDB-style file with coordinates for d4feqa_.
(The format of our PDB-style files is described here.)

Timeline for d4feqa_: