SCOPe 2.08: Domain d4fe2a_: 4fe2 A:

Lineage for d4fe2a_ (4fe2 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.0: automated matches [191445] (1 protein)
   not a true family

6. Protein automated matches [190664] (8 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [226677] (3 PDB entries)

8. Domain d4fe2a_: 4fe2 A: [221156]
   automated match to d2yzla_
   complexed with 144, act, adp, air, asp, cl, mg

Details for d4fe2a_

PDB Entry: 4fe2, 2.29 Å

PDB Description: X-Ray Structure of SAICAR Synthetase (PurC) from Streptococcus pneumoniae complexed with AIR, ADP, Asp and Mg2+

PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d4fe2a_:

Sequence; same for both SEQRES and ATOM records:

>d4fe2a_ d.143.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kqliysgkakdiyttedenliistykdqatafngvkkeqiagkgvlnnqissfifeklnv
agvathfveklsdteqlnkkvkiiplevvlrnytagsfskrfgvdegialetpivefyyk
nddlddpfindehvkflqiagdqqiaylkeetrrinellkvwfaeiglklidfklefgfd
kdgkiiladefspdncrlwdadgnhmdkdvfrrglgeltdvyeivweklqelk

Timeline for d4fe2a_:

• d4fe2a_ first appeared in SCOPe 2.03
  
• d4fe2a_ appears in SCOPe 2.07