![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) ![]() |
![]() | Family d.278.1.1: H-NOX domain [111127] (2 proteins) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains automatically mapped to Pfam PF07700 |
![]() | Protein Methyl-accepting chemotaxis protein [111128] (1 species) |
![]() | Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries) Uniprot Q8RBX6 1-191 |
![]() | Domain d4fdka_: 4fdk A: [221154] automated match to d1u55b_ complexed with hem, oxy |
PDB Entry: 4fdk (more details), 2.1 Å
SCOPe Domain Sequences for d4fdka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fdka_ d.278.1.1 (A:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]} mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg knvneiwrevgrqniktlsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn pvfeykkn
Timeline for d4fdka_: