![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) ![]() |
![]() | Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
![]() | Protein automated matches [190706] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [226632] (1 PDB entry) |
![]() | Domain d4fdfb_: 4fdf B: [221153] automated match to d2eeya_ |
PDB Entry: 4fdf (more details), 2.2 Å
SCOPe Domain Sequences for d4fdfb_:
Sequence, based on SEQRES records: (download)
>d4fdfb_ d.58.21.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} aahmvditekattkrtavaagilrtsaqvvalistgglpkgdalatarvagimaakrtsd liplchqlaltgvdvdftvgqldieitatvrstdrtgvemealtavsvaaltlydmikav dpgaliddirvlhkeggrrgtwtr
>d4fdfb_ d.58.21.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} aahmvditekattkrtavaagilrtsaqvvalistgglpkgdalatarvagimaakrtsd liplchqlaltgvdvdftvgqldieitatvrstdrtgvemealtavsvaaltlydmikav dpgaliddirvlhketwtr
Timeline for d4fdfb_: