Lineage for d4fdfa_ (4fdf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954453Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2954459Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 2954460Protein automated matches [190706] (6 species)
    not a true protein
  7. 2954469Species Mycobacterium tuberculosis [TaxId:1773] [226632] (1 PDB entry)
  8. 2954470Domain d4fdfa_: 4fdf A: [221152]
    automated match to d2eeya_

Details for d4fdfa_

PDB Entry: 4fdf (more details), 2.2 Å

PDB Description: structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein C 2

SCOPe Domain Sequences for d4fdfa_:

Sequence, based on SEQRES records: (download)

>d4fdfa_ d.58.21.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gaahmvditekattkrtavaagilrtsaqvvalistgglpkgdalatarvagimaakrts
dliplchqlaltgvdvdftvgqldieitatvrstdrtgvemealtavsvaaltlydmika
vdpgaliddirvlhkeggrrgtwtrr

Sequence, based on observed residues (ATOM records): (download)

>d4fdfa_ d.58.21.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gaahmvditkrtavaagilrtsaqvvalistgglpkgdalatarvagimaakrtsdlipl
chqlaltgvdvdftvgqldieitatvrstdrtgvemealtavsvaaltlydmikavdpga
liddirvlhketrr

SCOPe Domain Coordinates for d4fdfa_:

Click to download the PDB-style file with coordinates for d4fdfa_.
(The format of our PDB-style files is described here.)

Timeline for d4fdfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fdfb_