SCOPe 2.08: Domain d4fd9a_: 4fd9 A:

Lineage for d4fd9a_ (4fd9 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226633] (2 PDB entries)

8. Domain d4fd9a_: 4fd9 A: [221150]
   automated match to d1e7na_

Details for d4fd9a_

PDB Entry: 4fd9, 1.86 Å

PDB Description: Crystal structure of the third beta-gamma-crystallin domain of Crybg3 (betagamma-crystallin domain-containing protein 3) from Mus musculus

PDB Compounds: (A:) Beta/gamma crystallin domain-containing protein 3

SCOPe Domain Sequences for d4fd9a_:

Sequence; same for both SEQRES and ATOM records:

>d4fd9a_ b.11.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mnlkvilyekphflghtkefsehidsvptflksdkdfhgigsirviggvwvayekehfkg
qqflleegdfedssacgalsgpimsfrylqan

Timeline for d4fd9a_:

• d4fd9a_ first appeared in SCOPe 2.03
  
• d4fd9a_ appears in SCOPe 2.07