SCOPe 2.06: Domain d4fckb_: 4fck B:

Lineage for d4fckb_ (4fck B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein automated matches [190112] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)

8. Domain d4fckb_: 4fck B: [221146]
   automated match to d2zava_
   complexed with co, gpa

Details for d4fckb_

PDB Entry: 4fck, 1.9 Å

PDB Description: crystal structure of the co2+2-human arginase i-agpa complex

PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d4fckb_:

Sequence; same for both SEQRES and ATOM records:

>d4fckb_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyln

Timeline for d4fckb_:

• d4fckb_ first appeared in SCOPe 2.03
  
• d4fckb_ appears in SCOPe 2.05
  
• d4fckb_ appears in SCOPe 2.07
  
• d4fckb_ appears in the current release, SCOPe 2.08