Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries) |
Domain d4fcjb1: 4fcj B:1-138 [221144] Other proteins in same PDB: d4fcjb2 automated match to d4fcma_ complexed with gol |
PDB Entry: 4fcj (more details), 1.62 Å
SCOPe Domain Sequences for d4fcjb1:
Sequence, based on SEQRES records: (download)
>d4fcjb1 d.17.4.0 (B:1-138) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv ankfyvhndifryqdevf
>d4fcjb1 d.17.4.0 (B:1-138) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhgglpadavygqkeihrkv msqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapfyvhndifr yqdevf
Timeline for d4fcjb1: