Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries) |
Domain d4fcjb_: 4fcj B: [221144] automated match to d4fcma_ complexed with gol |
PDB Entry: 4fcj (more details), 1.62 Å
SCOPe Domain Sequences for d4fcjb_:
Sequence, based on SEQRES records: (download)
>d4fcjb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqk eihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegs vankfyvhndifryqdevf
>d4fcjb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhgglpadavygqkeihrk vmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapfyvhndif ryqdevf
Timeline for d4fcjb_: