Lineage for d4fcjb_ (4fcj B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405789Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)
  8. 1405791Domain d4fcjb_: 4fcj B: [221144]
    automated match to d4fcma_
    complexed with gol

Details for d4fcjb_

PDB Entry: 4fcj (more details), 1.62 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1
PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcjb_:

Sequence, based on SEQRES records: (download)

>d4fcjb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqk
eihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegs
vankfyvhndifryqdevf

Sequence, based on observed residues (ATOM records): (download)

>d4fcjb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhgglpadavygqkeihrk
vmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapfyvhndif
ryqdevf

SCOPe Domain Coordinates for d4fcjb_:

Click to download the PDB-style file with coordinates for d4fcjb_.
(The format of our PDB-style files is described here.)

Timeline for d4fcjb_: