SCOPe 2.06: Domain d4fcja_: 4fcj A:

Lineage for d4fcja_ (4fcj A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries)

8. Domain d4fcja_: 4fcj A: [221143]
   Other proteins in same PDB: d4fcjb2
   automated match to d4fcma_
   complexed with gol

Details for d4fcja_

PDB Entry: 4fcj, 1.62 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1

PDB Compounds: (A:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcja_:

Sequence, based on SEQRES records:

>d4fcja_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke
ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv
ankfyvhndifryqdev

Sequence, based on observed residues (ATOM records):

>d4fcja_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhadavygqkeihrkvmsqn
ftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyvhnd
ifryqdev

Timeline for d4fcja_:

• d4fcja_ first appeared in SCOPe 2.03
  
• d4fcja_ appears in SCOPe 2.05
  
• d4fcja_ appears in SCOPe 2.07
  
• d4fcja_ appears in the current release, SCOPe 2.08