| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Escherichia coli [TaxId:83334] [226481] (1 PDB entry) |
| Domain d4fcck2: 4fcc K:197-447 [221138] Other proteins in same PDB: d4fcca1, d4fccb1, d4fccc1, d4fccd1, d4fcce1, d4fccf1, d4fccg1, d4fcch1, d4fcci1, d4fccj1, d4fcck1, d4fccl1 automated match to d1bgva1 |
PDB Entry: 4fcc (more details), 2 Å
SCOPe Domain Sequences for d4fcck2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fcck2 c.2.1.0 (K:197-447) automated matches {Escherichia coli [TaxId: 83334]}
kglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga
rvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvylegqqpwsvpvd
ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg
vatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqganiagfvk
vadamlaqgvi
Timeline for d4fcck2: