SCOPe 2.06: Domain d4fccj2: 4fcc J:197-447

Lineage for d4fccj2 (4fcc J:197-447)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [226481] (1 PDB entry)

8. Domain d4fccj2: 4fcc J:197-447 [221136]
   Other proteins in same PDB: d4fcca1, d4fccb1, d4fccc1, d4fccd1, d4fcce1, d4fccf1, d4fccg1, d4fcch1, d4fcci1, d4fccj1, d4fcck1, d4fccl1
   automated match to d1bgva1

Details for d4fccj2

PDB Entry: 4fcc, 2 Å

PDB Description: Glutamate dehydrogenase from E. coli

PDB Compounds: (J:) glutamate dehydrogenase

SCOPe Domain Sequences for d4fccj2:

Sequence; same for both SEQRES and ATOM records:

>d4fccj2 c.2.1.0 (J:197-447) automated matches {Escherichia coli [TaxId: 83334]}
kglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga
rvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvylegqqpwsvpvd
ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg
vatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqganiagfvk
vadamlaqgvi

Timeline for d4fccj2:

• d4fccj2 first appeared in SCOPe 2.03
  
• d4fccj2 appears in SCOPe 2.05
  
• d4fccj2 appears in SCOPe 2.07
  
• d4fccj2 appears in the current release, SCOPe 2.08