![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (18 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [226480] (1 PDB entry) |
![]() | Domain d4fcch1: 4fcc H:6-196 [221131] Other proteins in same PDB: d4fcca2, d4fccb2, d4fccc2, d4fccd2, d4fcce2, d4fccf2, d4fccg2, d4fcch2, d4fcci2, d4fccj2, d4fcck2, d4fccl2 automated match to d1bgva2 |
PDB Entry: 4fcc (more details), 2 Å
SCOPe Domain Sequences for d4fcch1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fcch1 c.58.1.0 (H:6-196) automated matches {Escherichia coli [TaxId: 83334]} slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk lsnntacvftg
Timeline for d4fcch1: