Lineage for d4fcce1 (4fcc E:6-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890723Species Escherichia coli [TaxId:83334] [226480] (1 PDB entry)
  8. 2890728Domain d4fcce1: 4fcc E:6-196 [221125]
    Other proteins in same PDB: d4fcca2, d4fccb2, d4fccc2, d4fccd2, d4fcce2, d4fccf2, d4fccg2, d4fcch2, d4fcci2, d4fccj2, d4fcck2, d4fccl2
    automated match to d1bgva2

Details for d4fcce1

PDB Entry: 4fcc (more details), 2 Å

PDB Description: Glutamate dehydrogenase from E. coli
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d4fcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fcce1 c.58.1.0 (E:6-196) automated matches {Escherichia coli [TaxId: 83334]}
slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
lsnntacvftg

SCOPe Domain Coordinates for d4fcce1:

Click to download the PDB-style file with coordinates for d4fcce1.
(The format of our PDB-style files is described here.)

Timeline for d4fcce1: