SCOPe 2.06: Domain d4fbic_: 4fbi C:

Lineage for d4fbic_ (4fbi C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (10 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4fbic_: 4fbi C: [221104]
   automated match to d4f8da_
   complexed with gol; mutant

Details for d4fbic_

PDB Entry: 4fbi, 1.5 Å

PDB Description: Crystal Structure of an R46A mutant of the Restriction-Modification Controller Protein C.Esp1396I (Trigonal Form)

PDB Compounds: (C:) Regulatory protein

SCOPe Domain Sequences for d4fbic_:

Sequence; same for both SEQRES and ATOM records:

>d4fbic_ a.35.1.0 (C:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsanltikslelimkglev
sdvvffemlikeilk

Timeline for d4fbic_:

• d4fbic_ first appeared in SCOPe 2.03
  
• d4fbic_ appears in SCOPe 2.05
  
• d4fbic_ appears in SCOPe 2.07
  
• d4fbic_ appears in the current release, SCOPe 2.08