Lineage for d4fama_ (4fam A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829395Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2829396Species Human (Homo sapiens) [TaxId:9606] [102052] (50 PDB entries)
    Uniprot P42330
  8. 2829410Domain d4fama_: 4fam A: [221100]
    automated match to d4h7ca_
    complexed with 0sz, edo, nap

Details for d4fama_

PDB Entry: 4fam (more details), 2 Å

PDB Description: Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with 3-((3,4-dihydroisoquinolin-2(1H)-yl)sulfonyl)benzoic acid (17)
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d4fama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fama_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypys

SCOPe Domain Coordinates for d4fama_:

Click to download the PDB-style file with coordinates for d4fama_.
(The format of our PDB-style files is described here.)

Timeline for d4fama_: