Lineage for d1bglg1 (1bgl G:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762675Domain d1bglg1: 1bgl G:220-333 [22109]
    Other proteins in same PDB: d1bgla3, d1bgla4, d1bgla5, d1bglb3, d1bglb4, d1bglb5, d1bglc3, d1bglc4, d1bglc5, d1bgld3, d1bgld4, d1bgld5, d1bgle3, d1bgle4, d1bgle5, d1bglf3, d1bglf4, d1bglf5, d1bglg3, d1bglg4, d1bglg5, d1bglh3, d1bglh4, d1bglh5
    complexed with mg
    complexed with mg

Details for d1bglg1

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)
PDB Compounds: (G:) beta-galactosidase

SCOPe Domain Sequences for d1bglg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bglg1 b.1.4.1 (G:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1bglg1:

Click to download the PDB-style file with coordinates for d1bglg1.
(The format of our PDB-style files is described here.)

Timeline for d1bglg1: