SCOPe 2.03: Domain d4f8eb2: 4f8e B:161-317

Lineage for d4f8eb2 (4f8e B:161-317)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225156] (9 PDB entries)

8. Domain d4f8eb2: 4f8e B:161-317 [221087]
   automated match to d2c4ka2
   complexed with mg, so4; mutant

Details for d4f8eb2

PDB Entry: 4f8e, 2.27 Å

PDB Description: Crystal structure of human PRS1 D52H mutant

PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase 1

SCOPe Domain Sequences for d4f8eb2:

Sequence, based on SEQRES records:

>d4f8eb2 c.61.1.0 (B:161-317) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd
dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk
mkhcskiqvidismilaeairrthngesvsylfshvp

Sequence, based on observed residues (ATOM records):

>d4f8eb2 c.61.1.0 (B:161-317) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkedrmvlvgdvkdrvailvddmadtcg
tichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcski
qvidismilaeairrthngesvsylfshvp

Timeline for d4f8eb2:

• d4f8eb2 is new in SCOPe 2.03-stable
  
• d4f8eb2 appears in SCOPe 2.04
  
• d4f8eb2 appears in the current release, SCOPe 2.08