Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Nedd8 [54244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54245] (15 PDB entries) Uniprot Q15843 |
Domain d4f8cd_: 4f8c D: [221083] automated match to d2gbrc_ complexed with edo |
PDB Entry: 4f8c (more details), 1.95 Å
SCOPe Domain Sequences for d4f8cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f8cd_ d.15.1.1 (D:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlal
Timeline for d4f8cd_: