Lineage for d4f8cd_ (4f8c D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402240Protein Nedd8 [54244] (1 species)
  7. 1402241Species Human (Homo sapiens) [TaxId:9606] [54245] (10 PDB entries)
    Uniprot Q15843
  8. 1402248Domain d4f8cd_: 4f8c D: [221083]
    automated match to d2gbrc_
    complexed with edo

Details for d4f8cd_

PDB Entry: 4f8c (more details), 1.95 Å

PDB Description: Structure of the Cif:Nedd8 complex - Yersinia pseudotuberculosis Cycle Inhibiting Factor in complex with human Nedd8
PDB Compounds: (D:) nedd8

SCOPe Domain Sequences for d4f8cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f8cd_ d.15.1.1 (D:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlal

SCOPe Domain Coordinates for d4f8cd_:

Click to download the PDB-style file with coordinates for d4f8cd_.
(The format of our PDB-style files is described here.)

Timeline for d4f8cd_: