SCOPe 2.06: Domain d4f8cb_: 4f8c B:

Lineage for d4f8cb_ (4f8c B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Nedd8 [54244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
   Uniprot Q15843

8. Domain d4f8cb_: 4f8c B: [221082]
   automated match to d2gbrc_
   complexed with edo

Details for d4f8cb_

PDB Entry: 4f8c, 1.95 Å

PDB Description: Structure of the Cif:Nedd8 complex - Yersinia pseudotuberculosis Cycle Inhibiting Factor in complex with human Nedd8

PDB Compounds: (B:) nedd8

SCOPe Domain Sequences for d4f8cb_:

Sequence; same for both SEQRES and ATOM records:

>d4f8cb_ d.15.1.1 (B:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalr

Timeline for d4f8cb_:

• d4f8cb_ first appeared in SCOPe 2.03
  
• d4f8cb_ appears in SCOPe 2.05
  
• d4f8cb_ appears in SCOPe 2.07
  
• d4f8cb_ appears in the current release, SCOPe 2.08