SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4f7wc_ (4f7w C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110026Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 protein domains)
  6. 2110066Protein automated matches [227115] (2 species)
    not a true protein
  7. 2110070Species Klebsiella pneumoniae [TaxId:507522] [226631] (3 PDB entries)
  8. 2110083Domain d4f7wc_: 4f7w C: [221072]
    automated match to d1esma_
    complexed with adp, pn4, unx

Details for d4f7wc_

PDB Entry: 4f7w (more details), 2.1 Å

PDB Description: Crystal structure of Klebsiella pneumoniae pantothenate kinase in complex with N-pentylpantothenamide
PDB Compounds: (C:) pantothenate kinase

SCOPe Domain Sequences for d4f7wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7wc_ c.37.1.6 (C:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
lmtpylqfnrhqwaalrdsvpmtltedeitrlkginedlsleevaeiylplsrllnfyis
snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrhvelittd
gflhpnsvlkerglmkkkgfpqsydmhrlvkfvsdlksgvpqatapvyshliydvipdgd
ktvaqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapeellkswyinrflkf
regaftdpdsyfhnyaklskeeavdiatslwneinlmnlkenilptreraslimtksanh
svnqvrlrk

SCOPe Domain Coordinates for d4f7wc_:

Click to download the PDB-style file with coordinates for d4f7wc_.
(The format of our PDB-style files is described here.)

Timeline for d4f7wc_: