SCOPe 2.07: Domain d4f7ga2: 4f7g A:309-400

Lineage for d4f7ga2 (4f7g A:309-400)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Talin [82144] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries)

8. Domain d4f7ga2: 4f7g A:309-400 [221061]
   Other proteins in same PDB: d4f7ga1
   automated match to d1mixa2

Details for d4f7ga2

PDB Entry: 4f7g, 2.05 Å

PDB Description: Crystal structure of talin autoinhibition complex

PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d4f7ga2:

Sequence; same for both SEQRES and ATOM records:

>d4f7ga2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

Timeline for d4f7ga2:

• d4f7ga2 first appeared in SCOPe 2.03
  
• d4f7ga2 appears in SCOPe 2.06
  
• d4f7ga2 appears in the current release, SCOPe 2.08