![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
![]() | Protein Talin [82144] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries) |
![]() | Domain d4f7ga2: 4f7g A:309-400 [221061] Other proteins in same PDB: d4f7ga1 automated match to d1mixa2 |
PDB Entry: 4f7g (more details), 2.05 Å
SCOPe Domain Sequences for d4f7ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7ga2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl dfgdyqdgyysvqttegeqiaqliagyidiil
Timeline for d4f7ga2: