Lineage for d4f7ga2 (4f7g A:309-400)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799258Family b.55.1.5: Third domain of FERM [50776] (9 proteins)
  6. 1799306Protein Talin [82144] (1 species)
  7. 1799307Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries)
  8. 1799309Domain d4f7ga2: 4f7g A:309-400 [221061]
    Other proteins in same PDB: d4f7ga1
    automated match to d1mixa2

Details for d4f7ga2

PDB Entry: 4f7g (more details), 2.05 Å

PDB Description: Crystal structure of talin autoinhibition complex
PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d4f7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7ga2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

SCOPe Domain Coordinates for d4f7ga2:

Click to download the PDB-style file with coordinates for d4f7ga2.
(The format of our PDB-style files is described here.)

Timeline for d4f7ga2: