![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
![]() | Protein Talin [81716] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [226412] (1 PDB entry) |
![]() | Domain d4f7ga1: 4f7g A:209-308 [221060] Other proteins in same PDB: d4f7ga2 automated match to d1mixa1 |
PDB Entry: 4f7g (more details), 2.05 Å
SCOPe Domain Sequences for d4f7ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7ga1 a.11.2.1 (A:209-308) Talin {Mouse (Mus musculus) [TaxId: 10090]} pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk eyvkqkgerkifqahkncgqmseieakvryvklarslkty
Timeline for d4f7ga1: