Lineage for d4f7ga1 (4f7g A:209-308)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697470Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 2697520Protein Talin [81716] (2 species)
  7. 2697531Species Mouse (Mus musculus) [TaxId:10090] [226412] (1 PDB entry)
  8. 2697532Domain d4f7ga1: 4f7g A:209-308 [221060]
    Other proteins in same PDB: d4f7ga2
    automated match to d1mixa1

Details for d4f7ga1

PDB Entry: 4f7g (more details), 2.05 Å

PDB Description: Crystal structure of talin autoinhibition complex
PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d4f7ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7ga1 a.11.2.1 (A:209-308) Talin {Mouse (Mus musculus) [TaxId: 10090]}
pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
eyvkqkgerkifqahkncgqmseieakvryvklarslkty

SCOPe Domain Coordinates for d4f7ga1:

Click to download the PDB-style file with coordinates for d4f7ga1.
(The format of our PDB-style files is described here.)

Timeline for d4f7ga1: