SCOPe 2.03: Domain d4f7db2: 4f7d B:116-271

Lineage for d4f7db2 (4f7d B:116-271)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (12 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [226397] (2 PDB entries)

8. Domain d4f7db2: 4f7d B:116-271 [221059]
   Other proteins in same PDB: d4f7da1, d4f7db1
   automated match to d1a8pa2

Details for d4f7db2

PDB Entry: 4f7d, 2.35 Å

PDB Description: Crystal structure of ferredoxin-NADP reductase from burkholderia thailandensis E264

PDB Compounds: (B:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d4f7db2:

Sequence, based on SEQRES records:

>d4f7db2 c.25.1.0 (B:116-271) automated matches {Burkholderia thailandensis [TaxId: 271848]}
adnllpgktlwmlstgtglapfmsiirdpdiyerfdkvvlthtcrlkgelaymdyikhdl
pgheylgdvireklvyyptvtreefenegritdliasgklftdldmppfspeqdrvmlcg
stamlkdttellkkaglvegknsapghyvierafvd

Sequence, based on observed residues (ATOM records):

>d4f7db2 c.25.1.0 (B:116-271) automated matches {Burkholderia thailandensis [TaxId: 271848]}
adnllpgktlwmlstgtglapfmsiirdpdiyerfdkvvlthtcrlkgelaymdyikhdl
pgheylgdvireklvyyptvritdliasgklftdldmppfspeqdrvmlcgstamlkdtt
ellkkaglvegknsapghyvierafvd

Timeline for d4f7db2:

• d4f7db2 is new in SCOPe 2.03-stable
  
• d4f7db2 appears in SCOPe 2.04
  
• d4f7db2 appears in the current release, SCOPe 2.08