SCOPe 2.06: Domain d4f7da1: 4f7d A:17-115

Lineage for d4f7da1 (4f7d A:17-115)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (20 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [226396] (2 PDB entries)

8. Domain d4f7da1: 4f7d A:17-115 [221056]
   Other proteins in same PDB: d4f7da2, d4f7db2
   automated match to d1a8pa1

Details for d4f7da1

PDB Entry: 4f7d, 2.35 Å

PDB Description: Crystal structure of ferredoxin-NADP reductase from burkholderia thailandensis E264

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d4f7da1:

Sequence; same for both SEQRES and ATOM records:

>d4f7da1 b.43.4.0 (A:17-115) automated matches {Burkholderia thailandensis [TaxId: 271848]}
skfdtatvlsvhhwtdtlfsftctrdqalrfnngeftmvglevdgkpltraysivspnye
ehleffsikvqngpltsrlqhlkvgdpvligkkptgtlv

Timeline for d4f7da1:

• d4f7da1 first appeared in SCOPe 2.03
  
• d4f7da1 appears in SCOPe 2.05
  
• d4f7da1 appears in SCOPe 2.07
  
• d4f7da1 appears in the current release, SCOPe 2.08