SCOPe 2.06: Domain d4f6ha1: 4f6h A:4-220

Lineage for d4f6ha1 (4f6h A:4-220)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)

8. Domain d4f6ha1: 4f6h A:4-220 [221053]
   Other proteins in same PDB: d4f6ha2
   automated match to d4f6za_
   complexed with po4, so4, zn

Details for d4f6ha1

PDB Entry: 4f6h, 1.74 Å

PDB Description: mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4f6ha1:

Sequence; same for both SEQRES and ATOM records:

>d4f6ha1 d.157.1.1 (A:4-220) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfgggfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

Timeline for d4f6ha1:

• d4f6ha1 first appeared in SCOPe 2.03, called d4f6ha_
  
• d4f6ha1 was called d4f6ha_ in SCOPe 2.05
  
• d4f6ha1 appears in SCOPe 2.07
  
• d4f6ha1 appears in the current release, SCOPe 2.08