SCOPe 2.04: Domain d4f6ha_: 4f6h A:

Lineage for d4f6ha_ (4f6h A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (15 PDB entries)

8. Domain d4f6ha_: 4f6h A: [221053]
   automated match to d4f6za_
   complexed with po4, so4, zn

Details for d4f6ha_

PDB Entry: 4f6h, 1.74 Å

PDB Description: mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4f6ha_:

Sequence, based on SEQRES records:

>d4f6ha_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfgggfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglneskkpskpsnwshpqfek

Sequence, based on observed residues (ATOM records):

>d4f6ha_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfgggfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglneshpqfek

Timeline for d4f6ha_:

• d4f6ha_ first appeared in SCOPe 2.03
  
• d4f6ha_ appears in SCOPe 2.05
  
• d4f6ha_ appears in the current release, SCOPe 2.08, called d4f6ha1