Lineage for d4f6ha1 (4f6h A:4-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996767Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)
  8. 2996770Domain d4f6ha1: 4f6h A:4-220 [221053]
    Other proteins in same PDB: d4f6ha2
    automated match to d4f6za_
    complexed with po4, so4, zn

Details for d4f6ha1

PDB Entry: 4f6h (more details), 1.74 Å

PDB Description: mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4f6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ha1 d.157.1.1 (A:4-220) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfgggfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d4f6ha1:

Click to download the PDB-style file with coordinates for d4f6ha1.
(The format of our PDB-style files is described here.)

Timeline for d4f6ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f6ha2