| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins) lack the first helix but otherwise is more similar to conventional globins than the truncated ones automatically mapped to Pfam PF00042 |
| Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species) |
| Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (13 PDB entries) Uniprot O76242 |
| Domain d4f6fa_: 4f6f A: [221052] automated match to d4f6ba_ complexed with cmo, hem |
PDB Entry: 4f6f (more details), 1.56 Å
SCOPe Domain Sequences for d4f6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f6fa_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgfaiddilshl
Timeline for d4f6fa_: