SCOPe 2.05: Domain d4f6ec2: 4f6e C:91-207

Lineage for d4f6ec2 (4f6e C:91-207)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226252] (2 PDB entries)

8. Domain d4f6ec2: 4f6e C:91-207 [221049]
   Other proteins in same PDB: d4f6ea1, d4f6eb1, d4f6ec1, d4f6ed1
   automated match to d1kkca2
   complexed with gol, mly, mn, trs; mutant

Details for d4f6ec2

PDB Entry: 4f6e, 1.6 Å

PDB Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae

PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4f6ec2:

Sequence; same for both SEQRES and ATOM records:

>d4f6ec2 d.44.1.0 (C:91-207) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkrpdyfkaiwnvvnwkeasrrfdagki

Timeline for d4f6ec2:

• d4f6ec2 first appeared in SCOPe 2.03
  
• d4f6ec2 appears in SCOPe 2.04
  
• d4f6ec2 appears in SCOPe 2.06
  
• d4f6ec2 appears in the current release, SCOPe 2.08