Lineage for d4f6eb2 (4f6e B:91-205)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226252] (2 PDB entries)
  8. 1903913Domain d4f6eb2: 4f6e B:91-205 [221047]
    Other proteins in same PDB: d4f6ea1, d4f6eb1, d4f6ec1, d4f6ed1
    automated match to d1kkca2
    complexed with gol, mly, mn, trs; mutant

Details for d4f6eb2

PDB Entry: 4f6e (more details), 1.6 Å

PDB Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4f6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6eb2 d.44.1.0 (B:91-205) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkrpdyfkaiwnvvnwkeasrrfdag

SCOPe Domain Coordinates for d4f6eb2:

Click to download the PDB-style file with coordinates for d4f6eb2.
(The format of our PDB-style files is described here.)

Timeline for d4f6eb2: