![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226252] (2 PDB entries) |
![]() | Domain d4f6ea2: 4f6e A:91-207 [221045] Other proteins in same PDB: d4f6ea1, d4f6ea3, d4f6eb1, d4f6eb3, d4f6ec1, d4f6ec3, d4f6ed1, d4f6ed3 automated match to d1kkca2 complexed with gol, mly, mn, trs; mutant |
PDB Entry: 4f6e (more details), 1.6 Å
SCOPe Domain Sequences for d4f6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f6ea2 d.44.1.0 (A:91-207) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq tynqdtvtgplvplvaidawehayylqyqnkrpdyfkaiwnvvnwkeasrrfdagki
Timeline for d4f6ea2: