Lineage for d4f6ea2 (4f6e A:91-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946363Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226252] (2 PDB entries)
  8. 2946364Domain d4f6ea2: 4f6e A:91-207 [221045]
    Other proteins in same PDB: d4f6ea1, d4f6ea3, d4f6eb1, d4f6eb3, d4f6ec1, d4f6ec3, d4f6ed1, d4f6ed3
    automated match to d1kkca2
    complexed with gol, mly, mn, trs; mutant

Details for d4f6ea2

PDB Entry: 4f6e (more details), 1.6 Å

PDB Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4f6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ea2 d.44.1.0 (A:91-207) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkrpdyfkaiwnvvnwkeasrrfdagki

SCOPe Domain Coordinates for d4f6ea2:

Click to download the PDB-style file with coordinates for d4f6ea2.
(The format of our PDB-style files is described here.)

Timeline for d4f6ea2: