Lineage for d4f6ea1 (4f6e A:1-90)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256892Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1256893Protein automated matches [226859] (26 species)
    not a true protein
  7. 1256928Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226251] (2 PDB entries)
  8. 1256929Domain d4f6ea1: 4f6e A:1-90 [221044]
    Other proteins in same PDB: d4f6ea2, d4f6eb2, d4f6ec2, d4f6ed2
    automated match to d1kkca1
    complexed with gol, mly, mn, trs; mutant

Details for d4f6ea1

PDB Entry: 4f6e (more details), 1.6 Å

PDB Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4f6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ea1 a.2.11.0 (A:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

SCOPe Domain Coordinates for d4f6ea1:

Click to download the PDB-style file with coordinates for d4f6ea1.
(The format of our PDB-style files is described here.)

Timeline for d4f6ea1: