![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226251] (2 PDB entries) |
![]() | Domain d4f6ea1: 4f6e A:2-90 [221044] Other proteins in same PDB: d4f6ea2, d4f6ea3, d4f6eb2, d4f6eb3, d4f6ec2, d4f6ec3, d4f6ed2, d4f6ed3 automated match to d1kkca1 complexed with gol, mly, mn, trs; mutant |
PDB Entry: 4f6e (more details), 1.6 Å
SCOPe Domain Sequences for d4f6ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f6ea1 a.2.11.0 (A:2-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} vtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspana rkmiaiqqnikfhgggftnhclfwenlap
Timeline for d4f6ea1: