Lineage for d4f6ea1 (4f6e A:2-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690403Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226251] (2 PDB entries)
  8. 2690404Domain d4f6ea1: 4f6e A:2-90 [221044]
    Other proteins in same PDB: d4f6ea2, d4f6ea3, d4f6eb2, d4f6eb3, d4f6ec2, d4f6ec3, d4f6ed2, d4f6ed3
    automated match to d1kkca1
    complexed with gol, mly, mn, trs; mutant

Details for d4f6ea1

PDB Entry: 4f6e (more details), 1.6 Å

PDB Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4f6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ea1 a.2.11.0 (A:2-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspana
rkmiaiqqnikfhgggftnhclfwenlap

SCOPe Domain Coordinates for d4f6ea1:

Click to download the PDB-style file with coordinates for d4f6ea1.
(The format of our PDB-style files is described here.)

Timeline for d4f6ea1: