Class a: All alpha proteins [46456] (289 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (37 species) not a true protein |
Species Marinomonas sp. [TaxId:314277] [226403] (1 PDB entry) |
Domain d4f62b1: 4f62 B:1-290 [221039] Other proteins in same PDB: d4f62a2, d4f62b2 automated match to d3p8ra_ complexed with cl, gol, so4 |
PDB Entry: 4f62 (more details), 2.1 Å
SCOPe Domain Sequences for d4f62b1:
Sequence, based on SEQRES records: (download)
>d4f62b1 a.128.1.0 (B:1-290) automated matches {Marinomonas sp. [TaxId: 314277]} mnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfnggkrirpmltyasaqlvgd issltdasaaalesihayslihddlpamdndelrrgkptchiqfdeatailagdalqtfa fellsnptsaqpelaikliqelvvasgrngmitgqmidlssenknislaeleqmhvhktg alikasvrmgalstgqvkpeqlakldayahaiglafqvqddiidltsdtetlgktqfsda eankatypkllgldgakalvvrlheqaiaqisefgdksqpltdlanyiid
>d4f62b1 a.128.1.0 (B:1-290) automated matches {Marinomonas sp. [TaxId: 314277]} mnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfggkrirpmltyasaqlvgdi ssltdasaaalesihayslihddlpamfdeatailagdalqtfafellsnptsaqpelai kliqelvvasgrngmitgqmidlssenislaeleqmhvhktgalikasvrmgalstgqvk peqlakldayahaiglafqvqddiidlkatypkllgldgakalvvrlheqaiaqisefgd ksqpltdlanyiid
Timeline for d4f62b1: